Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys(Cys2&Cys30 bridge , Cys4&Cys19 bridge , Cys 9&Cys29 bridge)
Size : 0.1
P1(RMB) : 766
MW : 3442.1
One letter sequence : ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridge , C4&C19 bridge , C 9&C29 bridge)
Molecular Formula : C150H222N44O38S6
Description : Endogenous antibiotic peptide that exhibits a range of prominent anti-microbial activities against bacteria, fungi, and certain enveloped viruses.
Literature Reference : T. Ganz et al., J. Clin. Invest., 76, 1427 (1985); M.E. Selsted et al., J. Clin. Invest., 76, 1436 (1985); T. Ganz et al., Eur. J. Haematol, 44, 1 (1990)
Cas :